Package Bio :: Package GenBank :: Module Scanner
[hide private]
[frames] | no frames]

Source Code for Module Bio.GenBank.Scanner

   1  # Copyright 2007 by Peter Cock.  All rights reserved. 
   2  # This code is part of the Biopython distribution and governed by its 
   3  # license.  Please see the LICENSE file that should have been included 
   4  # as part of this package. 
   5  # 
   6  # This code is NOT intended for direct use.  It provides a basic scanner 
   7  # (for use with a event consumer such as Bio.GenBank._FeatureConsumer) 
   8  # to parse a GenBank or EMBL file (with their shared INSDC feature table). 
   9  # 
  10  # It is used by Bio.GenBank to parse GenBank files 
  11  # It is also used by Bio.SeqIO to parse GenBank and EMBL files 
  12  # 
  13  # Feature Table Documentation: 
  14  # http://www.insdc.org/files/feature_table.html 
  15  # http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html 
  16  # ftp://ftp.ncbi.nih.gov/genbank/docs/ 
  17   
  18  import sys 
  19  from Bio.Seq import Seq 
  20  from Bio.SeqRecord import SeqRecord 
  21  from Bio.Alphabet import generic_alphabet, generic_protein 
  22   
23 -class InsdcScanner :
24 """Basic functions for breaking up a GenBank/EMBL file into sub sections. 25 26 The International Nucleotide Sequence Database Collaboration (INSDC) 27 between the DDBJ, EMBL, and GenBank. These organisations all use the 28 same "Feature Table" layout in their plain text flat file formats. 29 30 However, the header and sequence sections of an EMBL file are very 31 different in layout to those produced by GenBank/DDBJ.""" 32 33 #These constants get redefined with sensible values in the sub classes: 34 RECORD_START = "XXX" # "LOCUS " or "ID " 35 HEADER_WIDTH = 3 # 12 or 5 36 FEATURE_START_MARKERS = ["XXX***FEATURES***XXX"] 37 FEATURE_END_MARKERS = ["XXX***END FEATURES***XXX"] 38 FEATURE_QUALIFIER_INDENT = 0 39 FEATURE_QUALIFIER_SPACER = "" 40 SEQUENCE_HEADERS=["XXX"] #with right hand side spaces removed 41
42 - def __init__(self, debug=0) :
43 assert len(self.RECORD_START)==self.HEADER_WIDTH 44 for marker in self.SEQUENCE_HEADERS : 45 assert marker==marker.rstrip() 46 assert len(self.FEATURE_QUALIFIER_SPACER)==self.FEATURE_QUALIFIER_INDENT 47 self.debug = debug 48 self.line = None
49
50 - def set_handle(self, handle) :
51 self.handle = handle 52 self.line = ""
53
54 - def find_start(self) :
55 """Read in lines until find the ID/LOCUS line, which is returned. 56 57 Any preamble (such as the header used by the NCBI on *.seq.gz archives) 58 will we ignored.""" 59 while True : 60 if self.line : 61 line = self.line 62 self.line = "" 63 else : 64 line = self.handle.readline() 65 if not line : 66 if self.debug : print "End of file" 67 return None 68 if line[:self.HEADER_WIDTH]==self.RECORD_START : 69 if self.debug > 1: print "Found the start of a record:\n" + line 70 break 71 line = line.rstrip() 72 if line == "//" : 73 if self.debug > 1: print "Skipping // marking end of last record" 74 elif line == "" : 75 if self.debug > 1: print "Skipping blank line before record" 76 else : 77 #Ignore any header before the first ID/LOCUS line. 78 if self.debug > 1: 79 print "Skipping header line before record:\n" + line 80 self.line = line 81 return line
82
83 - def parse_header(self) :
84 """Return list of strings making up the header 85 86 New line characters are removed. 87 88 Assumes you have just read in the ID/LOCUS line. 89 """ 90 assert self.line[:self.HEADER_WIDTH]==self.RECORD_START, \ 91 "Not at start of record" 92 93 header_lines = [] 94 while True : 95 line = self.handle.readline() 96 if not line : 97 raise ValueError("Premature end of line during sequence data") 98 line = line.rstrip() 99 if line in self.FEATURE_START_MARKERS : 100 if self.debug : print "Found header table" 101 break 102 #if line[:self.HEADER_WIDTH]==self.FEATURE_START_MARKER[:self.HEADER_WIDTH] : 103 # if self.debug : print "Found header table (?)" 104 # break 105 if line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS : 106 if self.debug : print "Found start of sequence" 107 break 108 if line == "//" : 109 raise ValueError("Premature end of sequence data marker '//' found") 110 header_lines.append(line) 111 self.line = line 112 return header_lines
113
114 - def parse_features(self, skip=False) :
115 """Return list of tuples for the features (if present) 116 117 Each feature is returned as a tuple (key, location, qualifiers) 118 where key and location are strings (e.g. "CDS" and 119 "complement(join(490883..490885,1..879))") while qualifiers 120 is a list of two string tuples (feature qualifier keys and values). 121 122 Assumes you have already read to the start of the features table. 123 """ 124 if self.line.rstrip() not in self.FEATURE_START_MARKERS : 125 if self.debug : print "Didn't find any feature table" 126 return [] 127 128 while self.line.rstrip() in self.FEATURE_START_MARKERS : 129 self.line = self.handle.readline() 130 131 features = [] 132 line = self.line 133 while True : 134 if not line : 135 raise ValueError("Premature end of line during features table") 136 if line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS : 137 if self.debug : print "Found start of sequence" 138 break 139 line = line.rstrip() 140 if line == "//" : 141 raise ValueError("Premature end of features table, marker '//' found") 142 if line in self.FEATURE_END_MARKERS : 143 if self.debug : print "Found end of features" 144 line = self.handle.readline() 145 break 146 if line[2:self.FEATURE_QUALIFIER_INDENT].strip() == "" : 147 raise ValueError("Expected a feature qualifier in line '%s'" % line) 148 149 if skip : 150 line = self.handle.readline() 151 while line[:self.FEATURE_QUALIFIER_INDENT] == self.FEATURE_QUALIFIER_SPACER : 152 line = self.handle.readline() 153 else : 154 #Build up a list of the lines making up this feature: 155 feature_key = line[2:self.FEATURE_QUALIFIER_INDENT].strip() 156 feature_lines = [line[self.FEATURE_QUALIFIER_INDENT:]] 157 line = self.handle.readline() 158 while line[:self.FEATURE_QUALIFIER_INDENT] == self.FEATURE_QUALIFIER_SPACER \ 159 or line.rstrip() == "" : # cope with blank lines in the midst of a feature 160 feature_lines.append(line[self.FEATURE_QUALIFIER_INDENT:].rstrip()) 161 line = self.handle.readline() 162 features.append(self.parse_feature(feature_key, feature_lines)) 163 self.line = line 164 return features
165
166 - def parse_feature(self, feature_key, lines) :
167 """Expects a feature as a list of strings, returns a tuple (key, location, qualifiers) 168 169 For example given this GenBank feature: 170 171 CDS complement(join(490883..490885,1..879)) 172 /locus_tag="NEQ001" 173 /note="conserved hypothetical [Methanococcus jannaschii]; 174 COG1583:Uncharacterized ACR; IPR001472:Bipartite nuclear 175 localization signal; IPR002743: Protein of unknown 176 function DUF57" 177 /codon_start=1 178 /transl_table=11 179 /product="hypothetical protein" 180 /protein_id="NP_963295.1" 181 /db_xref="GI:41614797" 182 /db_xref="GeneID:2732620" 183 /translation="MRLLLELKALNSIDKKQLSNYLIQGFIYNILKNTEYSWLHNWKK 184 EKYFNFTLIPKKDIIENKRYYLIISSPDKRFIEVLHNKIKDLDIITIGLAQFQLRKTK 185 KFDPKLRFPWVTITPIVLREGKIVILKGDKYYKVFVKRLEELKKYNLIKKKEPILEEP 186 IEISLNQIKDGWKIIDVKDRYYDFRNKSFSAFSNWLRDLKEQSLRKYNNFCGKNFYFE 187 EAIFEGFTFYKTVSIRIRINRGEAVYIGTLWKELNVYRKLDKEEREFYKFLYDCGLGS 188 LNSMGFGFVNTKKNSAR" 189 190 Then should give input key="CDS" and the rest of the data as a list of strings 191 lines=["complement(join(490883..490885,1..879))", ..., "LNSMGFGFVNTKKNSAR"] 192 where the leading spaces and trailing newlines have been removed. 193 194 Returns tuple containing: (key as string, location string, qualifiers as list) 195 as follows for this example: 196 197 key = "CDS", string 198 location = "complement(join(490883..490885,1..879))", string 199 qualifiers = list of string tuples: 200 201 [('locus_tag', '"NEQ001"'), 202 ('note', '"conserved hypothetical [Methanococcus jannaschii];\nCOG1583:..."'), 203 ('codon_start', '1'), 204 ('transl_table', '11'), 205 ('product', '"hypothetical protein"'), 206 ('protein_id', '"NP_963295.1"'), 207 ('db_xref', '"GI:41614797"'), 208 ('db_xref', '"GeneID:2732620"'), 209 ('translation', '"MRLLLELKALNSIDKKQLSNYLIQGFIYNILKNTEYSWLHNWKK\nEKYFNFT..."')] 210 211 In the above example, the "note" and "translation" were edited for compactness, 212 and they would contain multiple new line characters (displayed above as \n) 213 214 If a qualifier is quoted (in this case, everything except codon_start and 215 transl_table) then the quotes are NOT removed. 216 217 Note that no whitespace is removed. 218 """ 219 #Skip any blank lines 220 iterator = iter(filter(None, lines)) 221 try : 222 line = iterator.next() 223 224 feature_location = line.strip() 225 while feature_location[-1:]=="," : 226 #Multiline location, still more to come! 227 feature_location += iterator.next().strip() 228 229 qualifiers=[] 230 231 for line in iterator : 232 if line[0]=="/" : 233 #New qualifier 234 i = line.find("=") 235 key = line[1:i] #does not work if i==-1 236 value = line[i+1:] #we ignore 'value' if i==-1 237 if i==-1 : 238 #Qualifier with no key, e.g. /pseudo 239 key = line[1:] 240 qualifiers.append((key,None)) 241 elif value[0]=='"' : 242 #Quoted... 243 if value[-1]<>'"' or value<>'"' : 244 #No closing quote on the first line... 245 while value[-1] <> '"' : 246 value += "\n" + iterator.next() 247 else : 248 #One single line (quoted) 249 assert value == '"' 250 if self.debug : print "Quoted line %s:%s" % (key, value) 251 #DO NOT remove the quotes... 252 qualifiers.append((key,value)) 253 else : 254 #Unquoted 255 #if debug : print "Unquoted line %s:%s" % (key,value) 256 qualifiers.append((key,value)) 257 else : 258 #Unquoted continuation 259 assert len(qualifiers) > 0 260 assert key==qualifiers[-1][0] 261 #if debug : print "Unquoted Cont %s:%s" % (key, line) 262 qualifiers[-1] = (key, qualifiers[-1][1] + "\n" + line) 263 return (feature_key, feature_location, qualifiers) 264 except StopIteration: 265 #Bummer 266 raise ValueError("Problem with '%s' feature:\n%s" \ 267 % (feature_key, "\n".join(lines)))
268 289
290 - def _feed_first_line(self, consumer, line) :
291 """Handle the LOCUS/ID line, passing data to the comsumer 292 293 This should be implemented by the EMBL / GenBank specific subclass 294 295 Used by the parse_records() and parse() methods. 296 """ 297 pass
298
299 - def _feed_header_lines(self, consumer, lines) :
300 """Handle the header lines (list of strings), passing data to the comsumer 301 302 This should be implemented by the EMBL / GenBank specific subclass 303 304 Used by the parse_records() and parse() methods. 305 """ 306 pass
307 308
309 - def _feed_feature_table(self, consumer, feature_tuples) :
310 """Handle the feature table (list of tuples), passing data to the comsumer 311 312 Used by the parse_records() and parse() methods. 313 """ 314 consumer.start_feature_table() 315 for feature_key, location_string, qualifiers in feature_tuples : 316 consumer.feature_key(feature_key) 317 consumer.location(location_string) 318 for q_key, q_value in qualifiers : 319 consumer.feature_qualifier_name([q_key]) 320 if q_value is not None : 321 consumer.feature_qualifier_description(q_value.replace("\n"," "))
322
323 - def _feed_misc_lines(self, consumer, lines) :
324 """Handle any lines between features and sequence (list of strings), passing data to the consumer 325 326 This should be implemented by the EMBL / GenBank specific subclass 327 328 Used by the parse_records() and parse() methods. 329 """ 330 pass
331
332 - def feed(self, handle, consumer, do_features=True) :
333 """Feed a set of data into the consumer. 334 335 This method is intended for use with the "old" code in Bio.GenBank 336 337 Arguments: 338 handle - A handle with the information to parse. 339 consumer - The consumer that should be informed of events. 340 do_features - Boolean, should the features be parsed? 341 Skipping the features can be much faster. 342 343 Return values: 344 true - Passed a record 345 false - Did not find a record 346 """ 347 #Should work with both EMBL and GenBank files provided the 348 #equivalent Bio.GenBank._FeatureConsumer methods are called... 349 self.set_handle(handle) 350 if not self.find_start() : 351 #Could not find (another) record 352 consumer.data=None 353 return False 354 355 #We use the above class methods to parse the file into a simplified format. 356 #The first line, header lines and any misc lines after the features will be 357 #dealt with by GenBank / EMBL specific derived classes. 358 359 #First line and header: 360 self._feed_first_line(consumer, self.line) 361 self._feed_header_lines(consumer, self.parse_header()) 362 363 #Features (common to both EMBL and GenBank): 364 if do_features : 365 self._feed_feature_table(consumer, self.parse_features(skip=False)) 366 else : 367 self.parse_features(skip=True) # ignore the data 368 369 #Footer and sequence 370 misc_lines, sequence_string = self.parse_footer() 371 self._feed_misc_lines(consumer, misc_lines) 372 373 consumer.sequence(sequence_string) 374 #Calls to consumer.base_number() do nothing anyway 375 consumer.record_end("//") 376 377 assert self.line == "//" 378 379 #And we are done 380 return True
381
382 - def parse(self, handle, do_features=True) :
383 """Returns a SeqRecord (with SeqFeatures if do_features=True) 384 385 See also the method parse_records() for use on multi-record files. 386 """ 387 from Bio.GenBank import _FeatureConsumer 388 from Bio.GenBank.utils import FeatureValueCleaner 389 390 consumer = _FeatureConsumer(use_fuzziness = 1, 391 feature_cleaner = FeatureValueCleaner()) 392 393 if self.feed(handle, consumer) : 394 return consumer.data 395 else : 396 return None
397 398
399 - def parse_records(self, handle, do_features=True) :
400 """Returns a SeqRecord object iterator 401 402 Each record (from the ID/LOCUS line to the // line) becomes a SeqRecord 403 404 The SeqRecord objects include SeqFeatures if do_features=True 405 406 This method is intended for use in Bio.SeqIO 407 """ 408 #This is a generator function 409 while True : 410 record = self.parse(handle) 411 if record is None : break 412 assert record.id is not None 413 assert record.name <> "<unknown name>" 414 assert record.description <> "<unknown description>" 415 yield record
416
417 - def parse_cds_features(self, handle, 418 alphabet=generic_protein, 419 tags2id=('protein_id','locus_tag','product')) :
420 """Returns SeqRecord object iterator 421 422 Each CDS feature becomes a SeqRecord. 423 424 alphabet - Used for any sequence found in a translation field. 425 tags2id - Tupple of three strings, the feature keys to use 426 for the record id, name and description, 427 428 This method is intended for use in Bio.SeqIO 429 """ 430 self.set_handle(handle) 431 while self.find_start() : 432 #Got an EMBL or GenBank record... 433 self.parse_header() # ignore header lines! 434 feature_tuples = self.parse_features() 435 #self.parse_footer() # ignore footer lines! 436 for line in self.handle : 437 if line[:2]=="//" : break 438 self.line = line.rstrip() 439 440 #Now go though those features... 441 for key, location_string, qualifiers in feature_tuples : 442 if key=="CDS" : 443 #Create SeqRecord 444 #================ 445 #SeqRecord objects cannot be created with annotations, they 446 #must be added afterwards. So create an empty record and 447 #then populate it: 448 record = SeqRecord(seq=None) 449 annotations = record.annotations 450 451 #Should we add a location object to the annotations? 452 #I *think* that only makes sense for SeqFeatures with their 453 #sub features... 454 annotations['raw_location'] = location_string.replace(' ','') 455 456 for (qualifier_name, qualifier_data) in qualifiers : 457 if qualifier_data is not None \ 458 and qualifier_data[0]=='"' and qualifier_data[-1]=='"' : 459 #Remove quotes 460 qualifier_data = qualifier_data[1:-1] 461 #Append the data to the annotation qualifier... 462 if qualifier_name == "translation" : 463 assert record.seq is None, "Multiple translations!" 464 record.seq = Seq(qualifier_data.replace("\n",""), alphabet) 465 elif qualifier_name == "db_xref" : 466 #its a list, possibly empty. Its safe to extend 467 record.dbxrefs.append(qualifier_data) 468 else : 469 if qualifier_data is not None : 470 qualifier_data = qualifier_data.replace("\n"," ").replace(" "," ") 471 try : 472 annotations[qualifier_name] += " " + qualifier_data 473 except KeyError : 474 #Not an addition to existing data, its the first bit 475 annotations[qualifier_name]= qualifier_data 476 477 #Fill in the ID, Name, Description 478 #================================= 479 try : 480 record.id = annotations[tags2id[0]] 481 except KeyError : 482 pass 483 try : 484 record.name = annotations[tags2id[1]] 485 except KeyError : 486 pass 487 try : 488 record.description = annotations[tags2id[2]] 489 except KeyError : 490 pass 491 492 yield record
493
494 -class EmblScanner(InsdcScanner) :
495 """For extracting chunks of information in EMBL files""" 496 497 RECORD_START = "ID " 498 HEADER_WIDTH = 5 499 FEATURE_START_MARKERS = ["FH Key Location/Qualifiers","FH"] 500 FEATURE_END_MARKERS = ["XX"] #XX can also mark the end of many things! 501 FEATURE_QUALIFIER_INDENT = 21 502 FEATURE_QUALIFIER_SPACER = "FT" + " " * (FEATURE_QUALIFIER_INDENT-2) 503 SEQUENCE_HEADERS=["SQ"] #Remove trailing spaces 504 538
539 - def _feed_first_line(self, consumer, line) :
540 assert line[:self.HEADER_WIDTH].rstrip() == "ID" 541 if line[self.HEADER_WIDTH:].count(";") == 6 : 542 #Looks like the semi colon separated style introduced in 2006 543 self._feed_first_line_new(consumer, line) 544 elif line[self.HEADER_WIDTH:].count(";") == 3 : 545 #Looks like the pre 2006 style 546 self._feed_first_line_old(consumer, line) 547 else : 548 raise ValueError('Did not recognise the ID line layout:\n' + line)
549
550 - def _feed_first_line_old(self, consumer, line) :
551 #Expects an ID line in the style before 2006, e.g. 552 #ID SC10H5 standard; DNA; PRO; 4870 BP. 553 #ID BSUB9999 standard; circular DNA; PRO; 4214630 BP. 554 assert line[:self.HEADER_WIDTH].rstrip() == "ID" 555 fields = [line[self.HEADER_WIDTH:].split(None,1)[0]] 556 fields.extend(line[self.HEADER_WIDTH:].split(None,1)[1].split(";")) 557 fields = [entry.strip() for entry in fields] 558 """ 559 The tokens represent: 560 0. Primary accession number 561 (space sep) 562 1. ??? (e.g. standard) 563 (semi-colon) 564 2. Topology and/or Molecule type (e.g. 'circular DNA' or 'DNA') 565 3. Taxonomic division (e.g. 'PRO') 566 4. Sequence length (e.g. '4639675 BP.') 567 """ 568 consumer.locus(fields[0]) #Should we also call the accession consumer? 569 consumer.residue_type(fields[2]) 570 consumer.data_file_division(fields[3]) 571 self._feed_seq_length(consumer, fields[4])
572
573 - def _feed_first_line_new(self, consumer, line) :
574 #Expects an ID line in the style introduced in 2006, e.g. 575 #ID X56734; SV 1; linear; mRNA; STD; PLN; 1859 BP. 576 #ID CD789012; SV 4; linear; genomic DNA; HTG; MAM; 500 BP. 577 assert line[:self.HEADER_WIDTH].rstrip() == "ID" 578 fields = [data.strip() for data in line[self.HEADER_WIDTH:].strip().split(";")] 579 assert len(fields) == 7 580 """ 581 The tokens represent: 582 0. Primary accession number 583 1. Sequence version number 584 2. Topology: 'circular' or 'linear' 585 3. Molecule type (e.g. 'genomic DNA') 586 4. Data class (e.g. 'STD') 587 5. Taxonomic division (e.g. 'PRO') 588 6. Sequence length (e.g. '4639675 BP.') 589 """ 590 591 consumer.locus(fields[0]) 592 593 #Call the accession consumer now, to make sure we record 594 #something as the record.id, in case there is no AC line 595 consumer.accession(fields[0]) 596 597 #TODO - How to deal with the version field? At the moment the consumer 598 #will try and use this for the ID which isn't ideal for EMBL files. 599 version_parts = fields[1].split() 600 if len(version_parts)==2 \ 601 and version_parts[0]=="SV" \ 602 and version_parts[1].isdigit() : 603 consumer.version_suffix(version_parts[1]) 604 605 #Based on how the old GenBank parser worked, merge these two: 606 consumer.residue_type(" ".join(fields[2:4])) #TODO - Store as two fields? 607 608 #consumer.xxx(fields[4]) #TODO - What should we do with the data class? 609 610 consumer.data_file_division(fields[5]) 611 612 self._feed_seq_length(consumer, fields[6])
613
614 - def _feed_seq_length(self, consumer, text) :
615 length_parts = text.split() 616 assert len(length_parts) == 2 617 assert length_parts[1].upper() in ["BP", "BP."] 618 consumer.size(length_parts[0])
619
620 - def _feed_header_lines(self, consumer, lines) :
621 EMBL_INDENT = self.HEADER_WIDTH 622 EMBL_SPACER = " " * EMBL_INDENT 623 consumer_dict = { 624 'AC' : 'accession', 625 'SV' : 'version', # SV line removed in June 2006, now part of ID line 626 'DE' : 'definition', 627 #'RN' : 'reference_num', 628 #'RP' : 'reference_bases', 629 #'RX' : reference cross reference... DOI or Pubmed 630 'RA' : 'authors', 631 'RT' : 'title', 632 'RL' : 'journal', 633 'OS' : 'organism', 634 'OC' : 'taxonomy', 635 #'DR' : data reference? 636 'CC' : 'comment', 637 #'XX' : splitter 638 } 639 #We have to handle the following specially: 640 #RX (depending on reference type...) 641 lines = filter(None,lines) 642 line_iter = iter(lines) 643 try : 644 while True : 645 try : 646 line = line_iter.next() 647 except StopIteration : 648 break 649 if not line : break 650 line_type = line[:EMBL_INDENT].strip() 651 data = line[EMBL_INDENT:].strip() 652 653 if line_type == 'XX' : 654 pass 655 elif line_type == 'RN' : 656 # Reformat reference numbers for the GenBank based consumer 657 # e.g. '[1]' becomes '1' 658 if data[0] == "[" and data[-1] == "]" : data = data[1:-1] 659 consumer.reference_num(data) 660 elif line_type == 'RP' : 661 # Reformat reference numbers for the GenBank based consumer 662 # e.g. '1-4639675' becomes '(bases 1 to 4639675)' 663 assert data.count("-")==1 664 consumer.reference_bases("(bases " + data.replace("-", " to ") + ")") 665 elif line_type == 'RX' : 666 # TODO - I have seen both DOI and PubMed reference cross references 667 # The GenBank based consumer and Reference class may need extending here. 668 pass 669 elif line_type == 'CC' : 670 # Have to pass a list of strings for this one (not just a string) 671 consumer.comment([data]) 672 elif line_type == 'DR' : 673 # TODO - Data reference... 674 pass 675 elif line_type in consumer_dict : 676 #Its a semi-automatic entry! 677 getattr(consumer, consumer_dict[line_type])(data) 678 else : 679 if self.debug : 680 print "Ignoring EMBL header line:\n%s" % line 681 except StopIteration : 682 raise ValueError("Problem with header")
683
684 - def _feed_misc_lines(self, consumer, lines) :
685 #TODO - Should we do something with the information on the SQ line(s)? 686 pass
687
688 -class GenBankScanner(InsdcScanner) :
689 """For extracting chunks of information in GenBank files""" 690 691 RECORD_START = "LOCUS " 692 HEADER_WIDTH = 12 693 FEATURE_START_MARKERS = ["FEATURES Location/Qualifiers","FEATURES"] 694 FEATURE_END_MARKERS = [] 695 FEATURE_QUALIFIER_INDENT = 21 696 FEATURE_QUALIFIER_SPACER = " " * FEATURE_QUALIFIER_INDENT 697 SEQUENCE_HEADERS=["CONTIG", "ORIGIN", "BASE COUNT"] # trailing spaces removed 698 740
741 - def _feed_first_line(self, consumer, line) :
742 ##################################### 743 # LOCUS line # 744 ##################################### 745 GENBANK_INDENT = self.HEADER_WIDTH 746 GENBANK_SPACER = " "*GENBANK_INDENT 747 assert line[0:GENBANK_INDENT] == 'LOCUS ', \ 748 'LOCUS line does not start correctly:\n' + line 749 750 #Have to break up the locus line, and handle the different bits of it. 751 #There are at least two different versions of the locus line... 752 if line[29:33] in [' bp ', ' aa '] : 753 #Old... 754 # 755 # Positions Contents 756 # --------- -------- 757 # 00:06 LOCUS 758 # 06:12 spaces 759 # 12:?? Locus name 760 # ??:?? space 761 # ??:29 Length of sequence, right-justified 762 # 29:33 space, bp, space 763 # 33:41 strand type 764 # 41:42 space 765 # 42:51 Blank (implies linear), linear or circular 766 # 51:52 space 767 # 52:55 The division code (e.g. BCT, VRL, INV) 768 # 55:62 space 769 # 62:73 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991) 770 # 771 assert line[29:33] in [' bp ', ' aa '] , \ 772 'LOCUS line does not contain size units at expected position:\n' + line 773 assert line[41:42] == ' ', \ 774 'LOCUS line does not contain space at position 42:\n' + line 775 assert line[42:51].strip() in ['','linear','circular'], \ 776 'LOCUS line does not contain valid entry (linear, circular, ...):\n' + line 777 assert line[51:52] == ' ', \ 778 'LOCUS line does not contain space at position 52:\n' + line 779 assert line[55:62] == ' ', \ 780 'LOCUS line does not contain spaces from position 56 to 62:\n' + line 781 assert line[64:65] == '-', \ 782 'LOCUS line does not contain - at position 65 in date:\n' + line 783 assert line[68:69] == '-', \ 784 'LOCUS line does not contain - at position 69 in date:\n' + line 785 786 name_and_length_str = line[GENBANK_INDENT:29] 787 while name_and_length_str.find(' ')<>-1 : 788 name_and_length_str = name_and_length_str.replace(' ',' ') 789 name_and_length = name_and_length_str.split(' ') 790 assert len(name_and_length)<=2, \ 791 'Cannot parse the name and length in the LOCUS line:\n' + line 792 assert len(name_and_length)<>1, \ 793 'Name and length collide in the LOCUS line:\n' + line 794 #Should be possible to split them based on position, if 795 #a clear definition of the standard exists THAT AGREES with 796 #existing files. 797 consumer.locus(name_and_length[0]) 798 consumer.size(name_and_length[1]) 799 #consumer.residue_type(line[33:41].strip()) 800 801 if line[33:51].strip() == "" and line[29:33] == ' aa ' : 802 #Amino acids -> protein (even if there is no residue type given) 803 #We want to use a protein alphabet in this case, rather than a 804 #generic one. Not sure if this is the best way to achieve this, 805 #but it works because the scanner checks for this: 806 consumer.residue_type("PROTEIN") 807 else : 808 consumer.residue_type(line[33:51].strip()) 809 810 consumer.data_file_division(line[52:55]) 811 consumer.date(line[62:73]) 812 elif line[40:44] in [' bp ', ' aa '] : 813 #New... 814 # 815 # Positions Contents 816 # --------- -------- 817 # 00:06 LOCUS 818 # 06:12 spaces 819 # 12:?? Locus name 820 # ??:?? space 821 # ??:40 Length of sequence, right-justified 822 # 40:44 space, bp, space 823 # 44:47 Blank, ss-, ds-, ms- 824 # 47:54 Blank, DNA, RNA, tRNA, mRNA, uRNA, snRNA, cDNA 825 # 54:55 space 826 # 55:63 Blank (implies linear), linear or circular 827 # 63:64 space 828 # 64:67 The division code (e.g. BCT, VRL, INV) 829 # 67:68 space 830 # 68:79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991) 831 # 832 assert line[40:44] in [' bp ', ' aa '] , \ 833 'LOCUS line does not contain size units at expected position:\n' + line 834 assert line[44:47] in [' ', 'ss-', 'ds-', 'ms-'], \ 835 'LOCUS line does not have valid strand type (Single stranded, ...):\n' + line 836 assert line[47:54].strip() == "" \ 837 or line[47:54].strip().find('DNA') <> -1 \ 838 or line[47:54].strip().find('RNA') <> -1, \ 839 'LOCUS line does not contain valid sequence type (DNA, RNA, ...):\n' + line 840 assert line[54:55] == ' ', \ 841 'LOCUS line does not contain space at position 55:\n' + line 842 assert line[55:63].strip() in ['','linear','circular'], \ 843 'LOCUS line does not contain valid entry (linear, circular, ...):\n' + line 844 assert line[63:64] == ' ', \ 845 'LOCUS line does not contain space at position 64:\n' + line 846 assert line[67:68] == ' ', \ 847 'LOCUS line does not contain space at position 68:\n' + line 848 assert line[70:71] == '-', \ 849 'LOCUS line does not contain - at position 71 in date:\n' + line 850 assert line[74:75] == '-', \ 851 'LOCUS line does not contain - at position 75 in date:\n' + line 852 853 name_and_length_str = line[GENBANK_INDENT:40] 854 while name_and_length_str.find(' ')<>-1 : 855 name_and_length_str = name_and_length_str.replace(' ',' ') 856 name_and_length = name_and_length_str.split(' ') 857 assert len(name_and_length)<=2, \ 858 'Cannot parse the name and length in the LOCUS line:\n' + line 859 assert len(name_and_length)<>1, \ 860 'Name and length collide in the LOCUS line:\n' + line 861 #Should be possible to split them based on position, if 862 #a clear definition of the stand exists THAT AGREES with 863 #existing files. 864 consumer.locus(name_and_length[0]) 865 consumer.size(name_and_length[1]) 866 867 if line[44:54].strip() == "" and line[40:44] == ' aa ' : 868 #Amino acids -> protein (even if there is no residue type given) 869 #We want to use a protein alphabet in this case, rather than a 870 #generic one. Not sure if this is the best way to achieve this, 871 #but it works because the scanner checks for this: 872 consumer.residue_type(("PROTEIN " + line[54:63]).strip()) 873 else : 874 consumer.residue_type(line[44:63].strip()) 875 876 consumer.data_file_division(line[64:67]) 877 consumer.date(line[68:79]) 878 elif line[GENBANK_INDENT:].strip().count(" ")==0 : 879 #Truncated LOCUS line, as produced by some EMBOSS tools - see bug 1762 880 # 881 #e.g. 882 # 883 # "LOCUS U00096" 884 # 885 #rather than: 886 # 887 # "LOCUS U00096 4639675 bp DNA circular BCT" 888 # 889 # Positions Contents 890 # --------- -------- 891 # 00:06 LOCUS 892 # 06:12 spaces 893 # 12:?? Locus name 894 if line[GENBANK_INDENT:].strip() <> "" : 895 consumer.locus(line[GENBANK_INDENT:].strip()) 896 else : 897 #Must just have just "LOCUS ", is this even legitimate? 898 #We should be able to continue parsing... we need real world testcases! 899 print >> sys.stderr, "Warning: Minimal LOCUS line found - is this correct?\n" + line 900 else : 901 raise ValueError('Did not recognise the LOCUS line layout:\n' + line)
902 903
904 - def _feed_header_lines(self, consumer, lines) :
905 #Following dictionary maps GenBank lines to the associated 906 #consumer methods - the special cases like LOCUS where one 907 #genbank line triggers several consumer calls have to be 908 #handled individually. 909 GENBANK_INDENT = self.HEADER_WIDTH 910 GENBANK_SPACER = " "*GENBANK_INDENT 911 consumer_dict = { 912 'DEFINITION' : 'definition', 913 'ACCESSION' : 'accession', 914 'NID' : 'nid', 915 'PID' : 'pid', 916 'DBSOURCE' : 'db_source', 917 'KEYWORDS' : 'keywords', 918 'SEGMENT' : 'segment', 919 'SOURCE' : 'source', 920 'AUTHORS' : 'authors', 921 'CONSRTM' : 'consrtm', 922 'TITLE' : 'title', 923 'JOURNAL' : 'journal', 924 'MEDLINE' : 'medline_id', 925 'PUBMED' : 'pubmed_id', 926 'REMARK' : 'remark'} 927 #We have to handle the following specially: 928 #ORIGIN (locus, size, residue_type, data_file_division and date) 929 #COMMENT (comment) 930 #VERSION (version and gi) 931 #REFERENCE (eference_num and reference_bases) 932 #ORGANISM (organism and taxonomy) 933 lines = filter(None,lines) 934 lines.append("") #helps avoid getting StopIteration all the time 935 line_iter = iter(lines) 936 try : 937 line = line_iter.next() 938 while True : 939 if not line : break 940 line_type = line[:GENBANK_INDENT].strip() 941 data = line[GENBANK_INDENT:].strip() 942 943 if line_type == 'VERSION' : 944 #Need to call consumer.version(), and maybe also consumer.gi() as well. 945 #e.g. 946 # VERSION AC007323.5 GI:6587720 947 while data.find(' ')<>-1: 948 data = data.replace(' ',' ') 949 if data.find(' GI:')==-1 : 950 consumer.version(data) 951 else : 952 if self.debug : print "Version [" + data.split(' GI:')[0] + "], gi [" + data.split(' GI:')[1] + "]" 953 consumer.version(data.split(' GI:')[0]) 954 consumer.gi(data.split(' GI:')[1]) 955 #Read in the next line! 956 line = line_iter.next() 957 elif line_type == 'REFERENCE' : 958 if self.debug >1 : print "Found reference [" + data + "]" 959 #Need to call consumer.reference_num() and consumer.reference_bases() 960 #e.g. 961 # REFERENCE 1 (bases 1 to 86436) 962 # 963 #Note that this can be multiline, see Bug 1968, e.g. 964 # 965 # REFERENCE 42 (bases 1517 to 1696; 3932 to 4112; 17880 to 17975; 21142 to 966 # 28259) 967 # 968 #For such cases we will call the consumer once only. 969 data = data.strip() 970 971 #Read in the next line, and see if its more of the reference: 972 while True: 973 line = line_iter.next() 974 if line[:GENBANK_INDENT] == GENBANK_SPACER : 975 #Add this continuation to the data string 976 data += " " + line[GENBANK_INDENT:] 977 if self.debug >1 : print "Extended reference text [" + data + "]" 978 else : 979 #End of the reference, leave this text in the variable "line" 980 break 981 982 #We now have all the reference line(s) stored in a string, data, 983 #which we pass to the consumer 984 while data.find(' ')<>-1: 985 data = data.replace(' ',' ') 986 if data.find(' ')==-1 : 987 if self.debug >2 : print 'Reference number \"' + data + '\"' 988 consumer.reference_num(data) 989 else : 990 if self.debug >2 : print 'Reference number \"' + data[:data.find(' ')] + '\", \"' + data[data.find(' ')+1:] + '\"' 991 consumer.reference_num(data[:data.find(' ')]) 992 consumer.reference_bases(data[data.find(' ')+1:]) 993 elif line_type == 'ORGANISM' : 994 #The first line is the organism, but subsequent lines go to the taxonomy consumer 995 consumer.organism(data) 996 data = "" 997 while True : 998 line = line_iter.next() 999 if line[0:GENBANK_INDENT] == GENBANK_SPACER : 1000 data += ' ' + line[GENBANK_INDENT:] 1001 else : 1002 #We now have all the data for this taxonomy: 1003 if data.strip() == "" : 1004 if self.debug > 1 : print "Taxonomy line(s) missing or blank" 1005 consumer.taxonomy(data.strip()) 1006 #End of continuation - return to top of loop! 1007 break 1008 elif line_type == 'COMMENT' : 1009 if self.debug > 1 : print "Found comment" 1010 #This can be multiline, and should call consumer.comment() once 1011 #with a list where each entry is a line. 1012 comment_list=[] 1013 comment_list.append(data) 1014 while True: 1015 line = line_iter.next() 1016 if line[0:GENBANK_INDENT] == GENBANK_SPACER : 1017 data = line[GENBANK_INDENT:] 1018 comment_list.append(data) 1019 if self.debug > 2 : print "Comment continuation [" + data + "]" 1020 else : 1021 #End of the comment 1022 break 1023 consumer.comment(comment_list) 1024 del comment_list 1025 elif line_type in consumer_dict : 1026 #Its a semi-automatic entry! 1027 #Now, this may be a multi line entry... 1028 while True : 1029 line = line_iter.next() 1030 if line[0:GENBANK_INDENT] == GENBANK_SPACER : 1031 data += ' ' + line[GENBANK_INDENT:] 1032 else : 1033 #We now have all the data for this entry: 1034 getattr(consumer, consumer_dict[line_type])(data) 1035 #End of continuation - return to top of loop! 1036 break 1037 else : 1038 if self.debug : 1039 print "Ignoring GenBank header line:\n" % line 1040 #Read in next line 1041 line = line_iter.next() 1042 except StopIteration : 1043 raise ValueError("Problem in header")
1044
1045 - def _feed_misc_lines(self, consumer, lines) :
1046 #Deals with a few misc lines between the features and the sequence 1047 GENBANK_INDENT = self.HEADER_WIDTH 1048 GENBANK_SPACER = " "*GENBANK_INDENT 1049 lines.append("") 1050 line_iter = iter(lines) 1051 try : 1052 for line in line_iter : 1053 if line.find('BASE COUNT')==0 : 1054 line = line[10:].strip() 1055 if line : 1056 if self.debug : print "base_count = " + line 1057 consumer.base_count(line) 1058 if line.find("ORIGIN")==0 : 1059 line = line[6:].strip() 1060 if line : 1061 if self.debug : print "origin_name = " + line 1062 consumer.origin_name(line) 1063 if line.find("CONTIG")==0 : 1064 line = line[6:].strip() 1065 contig_location = line + '\n' 1066 while True : 1067 line = line_iter.next() 1068 if not line : 1069 break 1070 elif line[:GENBANK_INDENT]==GENBANK_SPACER : 1071 contig_location += line.rstrip() 1072 else: 1073 raise ValueError('Expected CONTIG continuation line, got:\n' + line) 1074 consumer.contig_location(contig_location) 1075 return 1076 except StopIteration : 1077 raise ValueError("Problem in misc lines before sequence")
1078 1079 if __name__ == "__main__" : 1080 from StringIO import StringIO 1081 1082 gbk_example = \ 1083 """LOCUS SCU49845 5028 bp DNA PLN 21-JUN-1999 1084 DEFINITION Saccharomyces cerevisiae TCP1-beta gene, partial cds, and Axl2p 1085 (AXL2) and Rev7p (REV7) genes, complete cds. 1086 ACCESSION U49845 1087 VERSION U49845.1 GI:1293613 1088 KEYWORDS . 1089 SOURCE Saccharomyces cerevisiae (baker's yeast) 1090 ORGANISM Saccharomyces cerevisiae 1091 Eukaryota; Fungi; Ascomycota; Saccharomycotina; Saccharomycetes; 1092 Saccharomycetales; Saccharomycetaceae; Saccharomyces. 1093 REFERENCE 1 (bases 1 to 5028) 1094 AUTHORS Torpey,L.E., Gibbs,P.E., Nelson,J. and Lawrence,C.W. 1095 TITLE Cloning and sequence of REV7, a gene whose function is required for 1096 DNA damage-induced mutagenesis in Saccharomyces cerevisiae 1097 JOURNAL Yeast 10 (11), 1503-1509 (1994) 1098 PUBMED 7871890 1099 REFERENCE 2 (bases 1 to 5028) 1100 AUTHORS Roemer,T., Madden,K., Chang,J. and Snyder,M. 1101 TITLE Selection of axial growth sites in yeast requires Axl2p, a novel 1102 plasma membrane glycoprotein 1103 JOURNAL Genes Dev. 10 (7), 777-793 (1996) 1104 PUBMED 8846915 1105 REFERENCE 3 (bases 1 to 5028) 1106 AUTHORS Roemer,T. 1107 TITLE Direct Submission 1108 JOURNAL Submitted (22-FEB-1996) Terry Roemer, Biology, Yale University, New 1109 Haven, CT, USA 1110 FEATURES Location/Qualifiers 1111 source 1..5028 1112 /organism="Saccharomyces cerevisiae" 1113 /db_xref="taxon:4932" 1114 /chromosome="IX" 1115 /map="9" 1116 CDS <1..206 1117 /codon_start=3 1118 /product="TCP1-beta" 1119 /protein_id="AAA98665.1" 1120 /db_xref="GI:1293614" 1121 /translation="SSIYNGISTSGLDLNNGTIADMRQLGIVESYKLKRAVVSSASEA 1122 AEVLLRVDNIIRARPRTANRQHM" 1123 gene 687..3158 1124 /gene="AXL2" 1125 CDS 687..3158 1126 /gene="AXL2" 1127 /note="plasma membrane glycoprotein" 1128 /codon_start=1 1129 /function="required for axial budding pattern of S. 1130 cerevisiae" 1131 /product="Axl2p" 1132 /protein_id="AAA98666.1" 1133 /db_xref="GI:1293615" 1134 /translation="MTQLQISLLLTATISLLHLVVATPYEAYPIGKQYPPVARVNESF 1135 TFQISNDTYKSSVDKTAQITYNCFDLPSWLSFDSSSRTFSGEPSSDLLSDANTTLYFN 1136 VILEGTDSADSTSLNNTYQFVVTNRPSISLSSDFNLLALLKNYGYTNGKNALKLDPNE 1137 VFNVTFDRSMFTNEESIVSYYGRSQLYNAPLPNWLFFDSGELKFTGTAPVINSAIAPE 1138 TSYSFVIIATDIEGFSAVEVEFELVIGAHQLTTSIQNSLIINVTDTGNVSYDLPLNYV 1139 YLDDDPISSDKLGSINLLDAPDWVALDNATISGSVPDELLGKNSNPANFSVSIYDTYG 1140 DVIYFNFEVVSTTDLFAISSLPNINATRGEWFSYYFLPSQFTDYVNTNVSLEFTNSSQ 1141 DHDWVKFQSSNLTLAGEVPKNFDKLSLGLKANQGSQSQELYFNIIGMDSKITHSNHSA 1142 NATSTRSSHHSTSTSSYTSSTYTAKISSTSAAATSSAPAALPAANKTSSHNKKAVAIA 1143 CGVAIPLGVILVALICFLIFWRRRRENPDDENLPHAISGPDLNNPANKPNQENATPLN 1144 NPFDDDASSYDDTSIARRLAALNTLKLDNHSATESDISSVDEKRDSLSGMNTYNDQFQ 1145 SQSKEELLAKPPVQPPESPFFDPQNRSSSVYMDSEPAVNKSWRYTGNLSPVSDIVRDS 1146 YGSQKTVDTEKLFDLEAPEKEKRTSRDVTMSSLDPWNSNISPSPVRKSVTPSPYNVTK 1147 HRNRHLQNIQDSQSGKNGITPTTMSTSSSDDFVPVKDGENFCWVHSMEPDRRPSKKRL 1148 VDFSNKSNVNVGQVKDIHGRIPEML" 1149 gene complement(3300..4037) 1150 /gene="REV7" 1151 CDS complement(3300..4037) 1152 /gene="REV7" 1153 /codon_start=1 1154 /product="Rev7p" 1155 /protein_id="AAA98667.1" 1156 /db_xref="GI:1293616" 1157 /translation="MNRWVEKWLRVYLKCYINLILFYRNVYPPQSFDYTTYQSFNLPQ 1158 FVPINRHPALIDYIEELILDVLSKLTHVYRFSICIINKKNDLCIEKYVLDFSELQHVD 1159 KDDQIITETEVFDEFRSSLNSLIMHLEKLPKVNDDTITFEAVINAIELELGHKLDRNR 1160 RVDSLEEKAEIERDSNWVKCQEDENLPDNNGFQPPKIKLTSLVGSDVGPLIIHQFSEK 1161 LISGDDKILNGVYSQYEEGESIFGSLF" 1162 ORIGIN 1163 1 gatcctccat atacaacggt atctccacct caggtttaga tctcaacaac ggaaccattg 1164 61 ccgacatgag acagttaggt atcgtcgaga gttacaagct aaaacgagca gtagtcagct 1165 121 ctgcatctga agccgctgaa gttctactaa gggtggataa catcatccgt gcaagaccaa 1166 181 gaaccgccaa tagacaacat atgtaacata tttaggatat acctcgaaaa taataaaccg 1167 241 ccacactgtc attattataa ttagaaacag aacgcaaaaa ttatccacta tataattcaa 1168 301 agacgcgaaa aaaaaagaac aacgcgtcat agaacttttg gcaattcgcg tcacaaataa 1169 361 attttggcaa cttatgtttc ctcttcgagc agtactcgag ccctgtctca agaatgtaat 1170 421 aatacccatc gtaggtatgg ttaaagatag catctccaca acctcaaagc tccttgccga 1171 481 gagtcgccct cctttgtcga gtaattttca cttttcatat gagaacttat tttcttattc 1172 541 tttactctca catcctgtag tgattgacac tgcaacagcc accatcacta gaagaacaga 1173 601 acaattactt aatagaaaaa ttatatcttc ctcgaaacga tttcctgctt ccaacatcta 1174 661 cgtatatcaa gaagcattca cttaccatga cacagcttca gatttcatta ttgctgacag 1175 721 ctactatatc actactccat ctagtagtgg ccacgcccta tgaggcatat cctatcggaa 1176 781 aacaataccc cccagtggca agagtcaatg aatcgtttac atttcaaatt tccaatgata 1177 841 cctataaatc gtctgtagac aagacagctc aaataacata caattgcttc gacttaccga 1178 901 gctggctttc gtttgactct agttctagaa cgttctcagg tgaaccttct tctgacttac 1179 961 tatctgatgc gaacaccacg ttgtatttca atgtaatact cgagggtacg gactctgccg 1180 1021 acagcacgtc tttgaacaat acataccaat ttgttgttac aaaccgtcca tccatctcgc 1181 1081 tatcgtcaga tttcaatcta ttggcgttgt taaaaaacta tggttatact aacggcaaaa 1182 1141 acgctctgaa actagatcct aatgaagtct tcaacgtgac ttttgaccgt tcaatgttca 1183 1201 ctaacgaaga atccattgtg tcgtattacg gacgttctca gttgtataat gcgccgttac 1184 1261 ccaattggct gttcttcgat tctggcgagt tgaagtttac tgggacggca ccggtgataa 1185 1321 actcggcgat tgctccagaa acaagctaca gttttgtcat catcgctaca gacattgaag 1186 1381 gattttctgc cgttgaggta gaattcgaat tagtcatcgg ggctcaccag ttaactacct 1187 1441 ctattcaaaa tagtttgata atcaacgtta ctgacacagg taacgtttca tatgacttac 1188 1501 ctctaaacta tgtttatctc gatgacgatc ctatttcttc tgataaattg ggttctataa 1189 1561 acttattgga tgctccagac tgggtggcat tagataatgc taccatttcc gggtctgtcc 1190 1621 cagatgaatt actcggtaag aactccaatc ctgccaattt ttctgtgtcc atttatgata 1191 1681 cttatggtga tgtgatttat ttcaacttcg aagttgtctc cacaacggat ttgtttgcca 1192 1741 ttagttctct tcccaatatt aacgctacaa ggggtgaatg gttctcctac tattttttgc 1193 1801 cttctcagtt tacagactac gtgaatacaa acgtttcatt agagtttact aattcaagcc 1194 1861 aagaccatga ctgggtgaaa ttccaatcat ctaatttaac attagctgga gaagtgccca 1195 1921 agaatttcga caagctttca ttaggtttga aagcgaacca aggttcacaa tctcaagagc 1196 1981 tatattttaa catcattggc atggattcaa agataactca ctcaaaccac agtgcgaatg 1197 2041 caacgtccac aagaagttct caccactcca cctcaacaag ttcttacaca tcttctactt 1198 2101 acactgcaaa aatttcttct acctccgctg ctgctacttc ttctgctcca gcagcgctgc 1199 2161 cagcagccaa taaaacttca tctcacaata aaaaagcagt agcaattgcg tgcggtgttg 1200 2221 ctatcccatt aggcgttatc ctagtagctc tcatttgctt cctaatattc tggagacgca 1201 2281 gaagggaaaa tccagacgat gaaaacttac cgcatgctat tagtggacct gatttgaata 1202 2341 atcctgcaaa taaaccaaat caagaaaacg ctacaccttt gaacaacccc tttgatgatg 1203 2401 atgcttcctc gtacgatgat acttcaatag caagaagatt ggctgctttg aacactttga 1204 2461 aattggataa ccactctgcc actgaatctg atatttccag cgtggatgaa aagagagatt 1205 2521 ctctatcagg tatgaataca tacaatgatc agttccaatc ccaaagtaaa gaagaattat 1206 2581 tagcaaaacc cccagtacag cctccagaga gcccgttctt tgacccacag aataggtctt 1207 2641 cttctgtgta tatggatagt gaaccagcag taaataaatc ctggcgatat actggcaacc 1208 2701 tgtcaccagt ctctgatatt gtcagagaca gttacggatc acaaaaaact gttgatacag 1209 2761 aaaaactttt cgatttagaa gcaccagaga aggaaaaacg tacgtcaagg gatgtcacta 1210 2821 tgtcttcact ggacccttgg aacagcaata ttagcccttc tcccgtaaga aaatcagtaa 1211 2881 caccatcacc atataacgta acgaagcatc gtaaccgcca cttacaaaat attcaagact 1212 2941 ctcaaagcgg taaaaacgga atcactccca caacaatgtc aacttcatct tctgacgatt 1213 3001 ttgttccggt taaagatggt gaaaattttt gctgggtcca tagcatggaa ccagacagaa 1214 3061 gaccaagtaa gaaaaggtta gtagattttt caaataagag taatgtcaat gttggtcaag 1215 3121 ttaaggacat tcacggacgc atcccagaaa tgctgtgatt atacgcaacg atattttgct 1216 3181 taattttatt ttcctgtttt attttttatt agtggtttac agatacccta tattttattt 1217 3241 agtttttata cttagagaca tttaatttta attccattct tcaaatttca tttttgcact 1218 3301 taaaacaaag atccaaaaat gctctcgccc tcttcatatt gagaatacac tccattcaaa 1219 3361 attttgtcgt caccgctgat taatttttca ctaaactgat gaataatcaa aggccccacg 1220 3421 tcagaaccga ctaaagaagt gagttttatt ttaggaggtt gaaaaccatt attgtctggt 1221 3481 aaattttcat cttcttgaca tttaacccag tttgaatccc tttcaatttc tgctttttcc 1222 3541 tccaaactat cgaccctcct gtttctgtcc aacttatgtc ctagttccaa ttcgatcgca 1223 3601 ttaataactg cttcaaatgt tattgtgtca tcgttgactt taggtaattt ctccaaatgc 1224 3661 ataatcaaac tatttaagga agatcggaat tcgtcgaaca cttcagtttc cgtaatgatc 1225 3721 tgatcgtctt tatccacatg ttgtaattca ctaaaatcta aaacgtattt ttcaatgcat 1226 3781 aaatcgttct ttttattaat aatgcagatg gaaaatctgt aaacgtgcgt taatttagaa 1227 3841 agaacatcca gtataagttc ttctatatag tcaattaaag caggatgcct attaatggga 1228 3901 acgaactgcg gcaagttgaa tgactggtaa gtagtgtagt cgaatgactg aggtgggtat 1229 3961 acatttctat aaaataaaat caaattaatg tagcatttta agtataccct cagccacttc 1230 4021 tctacccatc tattcataaa gctgacgcaa cgattactat tttttttttc ttcttggatc 1231 4081 tcagtcgtcg caaaaacgta taccttcttt ttccgacctt ttttttagct ttctggaaaa 1232 4141 gtttatatta gttaaacagg gtctagtctt agtgtgaaag ctagtggttt cgattgactg 1233 4201 atattaagaa agtggaaatt aaattagtag tgtagacgta tatgcatatg tatttctcgc 1234 4261 ctgtttatgt ttctacgtac ttttgattta tagcaagggg aaaagaaata catactattt 1235 4321 tttggtaaag gtgaaagcat aatgtaaaag ctagaataaa atggacgaaa taaagagagg 1236 4381 cttagttcat cttttttcca aaaagcaccc aatgataata actaaaatga aaaggatttg 1237 4441 ccatctgtca gcaacatcag ttgtgtgagc aataataaaa tcatcacctc cgttgccttt 1238 4501 agcgcgtttg tcgtttgtat cttccgtaat tttagtctta tcaatgggaa tcataaattt 1239 4561 tccaatgaat tagcaatttc gtccaattct ttttgagctt cttcatattt gctttggaat 1240 4621 tcttcgcact tcttttccca ttcatctctt tcttcttcca aagcaacgat ccttctaccc 1241 4681 atttgctcag agttcaaatc ggcctctttc agtttatcca ttgcttcctt cagtttggct 1242 4741 tcactgtctt ctagctgttg ttctagatcc tggtttttct tggtgtagtt ctcattatta 1243 4801 gatctcaagt tattggagtc ttcagccaat tgctttgtat cagacaattg actctctaac 1244 4861 ttctccactt cactgtcgag ttgctcgttt ttagcggaca aagatttaat ctcgttttct 1245 4921 ttttcagtgt tagattgctc taattctttg agctgttctc tcagctcctc atatttttct 1246 4981 tgccatgact cagattctaa ttttaagcta ttcaatttct ctttgatc 1247 //""" 1248 1249 # GenBank format protein (aka GenPept) file from: 1250 # http://www.molecularevolution.org/resources/fileformats/ 1251 gbk_example2 = \ 1252 """LOCUS AAD51968 143 aa linear BCT 21-AUG-2001 1253 DEFINITION transcriptional regulator RovA [Yersinia enterocolitica]. 1254 ACCESSION AAD51968 1255 VERSION AAD51968.1 GI:5805369 1256 DBSOURCE locus AF171097 accession AF171097.1 1257 KEYWORDS . 1258 SOURCE Yersinia enterocolitica 1259 ORGANISM Yersinia enterocolitica 1260 Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; 1261 Enterobacteriaceae; Yersinia. 1262 REFERENCE 1 (residues 1 to 143) 1263 AUTHORS Revell,P.A. and Miller,V.L. 1264 TITLE A chromosomally encoded regulator is required for expression of the 1265 Yersinia enterocolitica inv gene and for virulence 1266 JOURNAL Mol. Microbiol. 35 (3), 677-685 (2000) 1267 MEDLINE 20138369 1268 PUBMED 10672189 1269 REFERENCE 2 (residues 1 to 143) 1270 AUTHORS Revell,P.A. and Miller,V.L. 1271 TITLE Direct Submission 1272 JOURNAL Submitted (22-JUL-1999) Molecular Microbiology, Washington 1273 University School of Medicine, Campus Box 8230, 660 South Euclid, 1274 St. Louis, MO 63110, USA 1275 COMMENT Method: conceptual translation. 1276 FEATURES Location/Qualifiers 1277 source 1..143 1278 /organism="Yersinia enterocolitica" 1279 /mol_type="unassigned DNA" 1280 /strain="JB580v" 1281 /serotype="O:8" 1282 /db_xref="taxon:630" 1283 Protein 1..143 1284 /product="transcriptional regulator RovA" 1285 /name="regulates inv expression" 1286 CDS 1..143 1287 /gene="rovA" 1288 /coded_by="AF171097.1:380..811" 1289 /note="regulator of virulence" 1290 /transl_table=11 1291 ORIGIN 1292 1 mestlgsdla rlvrvwrali dhrlkplelt qthwvtlhni nrlppeqsqi qlakaigieq 1293 61 pslvrtldql eekglitrht candrrakri klteqsspii eqvdgvicst rkeilggisp 1294 121 deiellsgli dklerniiql qsk 1295 // 1296 """ 1297 1298 embl_example="""ID X56734; SV 1; linear; mRNA; STD; PLN; 1859 BP. 1299 XX 1300 AC X56734; S46826; 1301 XX 1302 DT 12-SEP-1991 (Rel. 29, Created) 1303 DT 25-NOV-2005 (Rel. 85, Last updated, Version 11) 1304 XX 1305 DE Trifolium repens mRNA for non-cyanogenic beta-glucosidase 1306 XX 1307 KW beta-glucosidase. 1308 XX 1309 OS Trifolium repens (white clover) 1310 OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; 1311 OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; 1312 OC eurosids I; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium. 1313 XX 1314 RN [5] 1315 RP 1-1859 1316 RX PUBMED; 1907511. 1317 RA Oxtoby E., Dunn M.A., Pancoro A., Hughes M.A.; 1318 RT "Nucleotide and derived amino acid sequence of the cyanogenic 1319 RT beta-glucosidase (linamarase) from white clover (Trifolium repens L.)"; 1320 RL Plant Mol. Biol. 17(2):209-219(1991). 1321 XX 1322 RN [6] 1323 RP 1-1859 1324 RA Hughes M.A.; 1325 RT ; 1326 RL Submitted (19-NOV-1990) to the EMBL/GenBank/DDBJ databases. 1327 RL Hughes M.A., University of Newcastle Upon Tyne, Medical School, Newcastle 1328 RL Upon Tyne, NE2 4HH, UK 1329 XX 1330 FH Key Location/Qualifiers 1331 FH 1332 FT source 1..1859 1333 FT /organism="Trifolium repens" 1334 FT /mol_type="mRNA" 1335 FT /clone_lib="lambda gt10" 1336 FT /clone="TRE361" 1337 FT /tissue_type="leaves" 1338 FT /db_xref="taxon:3899" 1339 FT CDS 14..1495 1340 FT /product="beta-glucosidase" 1341 FT /EC_number="3.2.1.21" 1342 FT /note="non-cyanogenic" 1343 FT /db_xref="GOA:P26204" 1344 FT /db_xref="InterPro:IPR001360" 1345 FT /db_xref="InterPro:IPR013781" 1346 FT /db_xref="UniProtKB/Swiss-Prot:P26204" 1347 FT /protein_id="CAA40058.1" 1348 FT /translation="MDFIVAIFALFVISSFTITSTNAVEASTLLDIGNLSRSSFPRGFI 1349 FT FGAGSSAYQFEGAVNEGGRGPSIWDTFTHKYPEKIRDGSNADITVDQYHRYKEDVGIMK 1350 FT DQNMDSYRFSISWPRILPKGKLSGGINHEGIKYYNNLINELLANGIQPFVTLFHWDLPQ 1351 FT VLEDEYGGFLNSGVINDFRDYTDLCFKEFGDRVRYWSTLNEPWVFSNSGYALGTNAPGR 1352 FT CSASNVAKPGDSGTGPYIVTHNQILAHAEAVHVYKTKYQAYQKGKIGITLVSNWLMPLD 1353 FT DNSIPDIKAAERSLDFQFGLFMEQLTTGDYSKSMRRIVKNRLPKFSKFESSLVNGSFDF 1354 FT IGINYYSSSYISNAPSHGNAKPSYSTNPMTNISFEKHGIPLGPRAASIWIYVYPYMFIQ 1355 FT EDFEIFCYILKINITILQFSITENGMNEFNDATLPVEEALLNTYRIDYYYRHLYYIRSA 1356 FT IRAGSNVKGFYAWSFLDCNEWFAGFTVRFGLNFVD" 1357 FT mRNA 1..1859 1358 FT /experiment="experimental evidence, no additional details 1359 FT recorded" 1360 XX 1361 SQ Sequence 1859 BP; 609 A; 314 C; 355 G; 581 T; 0 other; 1362 aaacaaacca aatatggatt ttattgtagc catatttgct ctgtttgtta ttagctcatt 60 1363 cacaattact tccacaaatg cagttgaagc ttctactctt cttgacatag gtaacctgag 120 1364 tcggagcagt tttcctcgtg gcttcatctt tggtgctgga tcttcagcat accaatttga 180 1365 aggtgcagta aacgaaggcg gtagaggacc aagtatttgg gataccttca cccataaata 240 1366 tccagaaaaa ataagggatg gaagcaatgc agacatcacg gttgaccaat atcaccgcta 300 1367 caaggaagat gttgggatta tgaaggatca aaatatggat tcgtatagat tctcaatctc 360 1368 ttggccaaga atactcccaa agggaaagtt gagcggaggc ataaatcacg aaggaatcaa 420 1369 atattacaac aaccttatca acgaactatt ggctaacggt atacaaccat ttgtaactct 480 1370 ttttcattgg gatcttcccc aagtcttaga agatgagtat ggtggtttct taaactccgg 540 1371 tgtaataaat gattttcgag actatacgga tctttgcttc aaggaatttg gagatagagt 600 1372 gaggtattgg agtactctaa atgagccatg ggtgtttagc aattctggat atgcactagg 660 1373 aacaaatgca ccaggtcgat gttcggcctc caacgtggcc aagcctggtg attctggaac 720 1374 aggaccttat atagttacac acaatcaaat tcttgctcat gcagaagctg tacatgtgta 780 1375 taagactaaa taccaggcat atcaaaaggg aaagataggc ataacgttgg tatctaactg 840 1376 gttaatgcca cttgatgata atagcatacc agatataaag gctgccgaga gatcacttga 900 1377 cttccaattt ggattgttta tggaacaatt aacaacagga gattattcta agagcatgcg 960 1378 gcgtatagtt aaaaaccgat tacctaagtt ctcaaaattc gaatcaagcc tagtgaatgg 1020 1379 ttcatttgat tttattggta taaactatta ctcttctagt tatattagca atgccccttc 1080 1380 acatggcaat gccaaaccca gttactcaac aaatcctatg accaatattt catttgaaaa 1140 1381 acatgggata cccttaggtc caagggctgc ttcaatttgg atatatgttt atccatatat 1200 1382 gtttatccaa gaggacttcg agatcttttg ttacatatta aaaataaata taacaatcct 1260 1383 gcaattttca atcactgaaa atggtatgaa tgaattcaac gatgcaacac ttccagtaga 1320 1384 agaagctctt ttgaatactt acagaattga ttactattac cgtcacttat actacattcg 1380 1385 ttctgcaatc agggctggct caaatgtgaa gggtttttac gcatggtcat ttttggactg 1440 1386 taatgaatgg tttgcaggct ttactgttcg ttttggatta aactttgtag attagaaaga 1500 1387 tggattaaaa aggtacccta agctttctgc ccaatggtac aagaactttc tcaaaagaaa 1560 1388 ctagctagta ttattaaaag aactttgtag tagattacag tacatcgttt gaagttgagt 1620 1389 tggtgcacct aattaaataa aagaggttac tcttaacata tttttaggcc attcgttgtg 1680 1390 aagttgttag gctgttattt ctattatact atgttgtagt aataagtgca ttgttgtacc 1740 1391 agaagctatg atcataacta taggttgatc cttcatgtat cagtttgatg ttgagaatac 1800 1392 tttgaattaa aagtcttttt ttattttttt aaaaaaaaaa aaaaaaaaaa aaaaaaaaa 1859 1393 // 1394 """ 1395 1396 print "GenBank CDS Iteration" 1397 print "=====================" 1398 1399 g = GenBankScanner() 1400 for record in g.parse_cds_features(StringIO(gbk_example)) : 1401 print record 1402 1403 g = GenBankScanner() 1404 for record in g.parse_cds_features(StringIO(gbk_example2), 1405 tags2id=('gene','locus_tag','product')) : 1406 print record 1407 1408 g = GenBankScanner() 1409 for record in g.parse_cds_features(StringIO(gbk_example + "\n" + gbk_example2), 1410 tags2id=('gene','locus_tag','product')) : 1411 print record 1412 1413 print 1414 print "GenBank Iteration" 1415 print "=================" 1416 g = GenBankScanner() 1417 for record in g.parse_records(StringIO(gbk_example),do_features=False) : 1418 print record.id, record.name, record.description 1419 print record.seq 1420 1421 g = GenBankScanner() 1422 for record in g.parse_records(StringIO(gbk_example),do_features=True) : 1423 print record.id, record.name, record.description 1424 print record.seq 1425 1426 g = GenBankScanner() 1427 for record in g.parse_records(StringIO(gbk_example2),do_features=False) : 1428 print record.id, record.name, record.description 1429 print record.seq 1430 1431 g = GenBankScanner() 1432 for record in g.parse_records(StringIO(gbk_example2),do_features=True) : 1433 print record.id, record.name, record.description 1434 print record.seq 1435 1436 print 1437 print "EMBL CDS Iteration" 1438 print "==================" 1439 1440 e = EmblScanner() 1441 for record in e.parse_cds_features(StringIO(embl_example)) : 1442 print record 1443 1444 print 1445 print "EMBL Iteration" 1446 print "==============" 1447 e = EmblScanner() 1448 for record in e.parse_records(StringIO(embl_example),do_features=True) : 1449 print record.id, record.name, record.description 1450 print record.seq 1451